PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4830110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family MYB
Protein Properties Length: 395aa    MW: 44054.2 Da    PI: 6.9084
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4830110.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
  Lj1g3v4830110.1 14 KGLWSPEEDEKLLRHITMYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding46.96.2e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE+ l++++++ lG++ W+ Ia  ++ gRt++++k+ w++
  Lj1g3v4830110.1  67 RGAFSQEEENLIIELHAVLGNR-WSQIATQLP-GRTDNEIKNLWNS 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.516961IPR017930Myb domain
SuperFamilySSF466894.12E-2912108IPR009057Homeodomain-like
SMARTSM007177.4E-131363IPR001005SANT/Myb domain
PfamPF002495.3E-151461IPR001005SANT/Myb domain
CDDcd001676.30E-111761No hitNo description
PROSITE profilePS5129426.19962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2565116IPR009057Homeodomain-like
SMARTSM007173.4E-1366114IPR001005SANT/Myb domain
PfamPF002491.0E-1367111IPR001005SANT/Myb domain
CDDcd001673.77E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT MYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQEEENLIIE LHAVLGNRWS QIATQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPVTHKPLS EVENGKEDKN KSQEKVSNEL NLLKSESFKS DAASYEQNSS SIAPKAYTTE  180
MEGSSSSNCS SKDLLLDRFM SQPQNLMGNY YPLQMSFAST DSAPTNSNSC HWFSQIGRPS  240
DVNSEYASNI MSILPPTSSF CYKPSLPVPL EDISTPSFAV NGSNYWEASA SNNSNSSNTS  300
DGIGSRELSS SNILSSSSWG LTDCSSSTEE AKWCEYLQNP MLMLEAAQNQ TPSKHLVPDT  360
LGAMLPHSKQ QEEPSQSSSI FSKDLQKLTA AFENI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.50620.0floral bud| pod| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0049670.0AP004967.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT27L02, TM0144, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007163255.10.0hypothetical protein PHAVU_001G219000g
TrEMBLV7CYS20.0V7CYS2_PHAVU; Uncharacterized protein
STRINGGLYMA19G41010.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.32e-95myb domain protein 55